PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g57460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 188aa    MW: 21480.5 Da    PI: 10.117
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g57460genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.3e-1964118256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tk+q   Lee F++n++++ +e+e LA++l+L +rqV vWFqNrRa+ k
  CA00g57460  64 RKKLRLTKQQSFLLEESFRQNHTLNPKEKEALAMQLKLRTRQVEVWFQNRRARSK 118
                 78889************************************************98 PP

2HD-ZIP_I/II111.17.3e-3664152189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl+k+q+ lLEesF+++++L+p++K++la +L+l++rqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL+keveeLr+
   CA00g57460  64 RKKLRLTKQQSFLLEESFRQNHTLNPKEKEALAMQLKLRTRQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNRRLKKEVEELRA 152
                  69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1747118IPR009057Homeodomain-like
SuperFamilySSF466898.36E-1947121IPR009057Homeodomain-like
PROSITE profilePS5007116.82760120IPR001356Homeobox domain
SMARTSM003898.1E-1762124IPR001356Homeobox domain
CDDcd000861.21E-1463121No hitNo description
PfamPF000461.9E-1664118IPR001356Homeobox domain
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PfamPF021832.9E-10120154IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-18120163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MPENSTCLEL TISIPGSSSN SSSFPSPGGG GYNMMRELDI NLVPSIQVSN NNNNNNNNNG  60
VPPRKKLRLT KQQSFLLEES FRQNHTLNPK EKEALAMQLK LRTRQVEVWF QNRRARSKLK  120
QTEMECEYLK RWFGSLTEQN RRLKKEVEEL RAMKVGVLSP HTCPSTLTMC PHCERVTTTT  180
IRDESRI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112120RRARSKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2387419e-33AC238741.2 Solanum lycopersicum chromosome 05 clone C05HBa0078I05, complete sequence.
GenBankHG9754449e-33HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755179e-33HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546780.11e-106PREDICTED: homeobox-leucine zipper protein ATHB-17
SwissprotQ8S9N61e-73ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
TrEMBLA0A068TXK64e-85A0A068TXK6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000783292e-83(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.19e-64homeobox-leucine zipper protein 17